Date: 2013-01-01

Creator: Elizabeth A. Stemmler, Elizabeth E. Barton, Onyinyechi K. Esonu, Daniel A. Polasky, Laura L., Onderko, Audrey B. Bergeron, Andrew E. Christie, Patsy S. Dickinson

Access: Open access

Neuropeptides are the largest class of signaling molecules used by nervous systems. Today, neuropeptidediscovery commonly involves chemical extraction from a tissue source followed by mass spectrometriccharacterization. Ideally, the extraction procedure accurately preserves the sequence and any inher-ent modifications of the native peptides. Here, we present data showing that this is not always true.Specifically, we present evidence showing that, in the lobster Homarus americanus, the orcokinin fam-ily members, NFDEIDRSGFG-OMe and SSEDMDRLGFG-OMe, are non-native peptides generated fromfull-length orcokinin precursors as the result of a highly selective peptide modification (peptide trun-cation with C-terminal methylation) that occurs during extraction. These peptides were observed byMALDI-FTMS and LC-Q-TOFMS analyses when eyestalk ganglia were extracted in a methanolic solvent,but not when tissues were dissected, co-crystallized with matrix, and analyzed directly with methanolexcluded from the sample preparation. The identity of NFDEIDRSGFG-OMe was established using MALDI-FTMS/SORI-CID, LC-Q-TOFMS/MS, and comparison with a peptide standard. Extraction substitutingdeuterated methanol for methanol confirmed that the latter is the source of the C-terminal methyl group,and MS/MS confirmed the C-terminal localization of the added CD3. Surprisingly, NFDEIDRSGFG-OMe isnot produced via a chemical acid-catalyzed esterification. Instead, the methylated peptide appears toresult from proteolytic truncation in the presence of methanol, as evidenced by a reduction in conver-sion with the addition of a protease-inhibitor cocktail; heat effectively eliminated the conversion. Thisunusual and highly specific extraction-derived peptide conversion exemplifies the need to consider bothchemical and biochemical processes that may modify the structure of endogenous neuropeptides. © 2013 The Authors. Published by Elsevier Inc. All rights reserved.

Date: 2009-02-01

Creator: Patsy S. Dickinson, Elizabeth A. Stemmler, Elizabeth E. Barton, Christopher R. Cashman, Noah P., Gardner, Szymon Rus, Henry R. Brennan, Timothy S. McClintock, Andrew E. Christie

Access: Open access

Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans. © 2008 Elsevier Inc. All rights reserved.