Showing 51 - 100 of 274 Items

Date: 2019-01-01

Creator: Aidan F. Coyle, Erin R. Voss, Carolyn K. Tepolt, David B. Carlon

Access: Open access

Hybrid zones provide natural experiments in recombination within and between genomes that may have strong effects on organismal fitness. On the East Coast of North America, two distinct lineages of the European green crab (Carcinus maenas) have been introduced in the last two centuries. These two lineages with putatively different adaptive properties have hybridized along the coast of the eastern Gulf of Maine, producing new nuclear and mitochondrial combinations that show clinal variation correlated with water temperature. To test the hypothesis that mitochondrial or nuclear genes have effects on thermal tolerance, we first measured the response to cold stress in crabs collected throughout the hybrid zone, then sequenced the mitochondrial CO1 gene and two nuclear single nucleotide polymorphisms (SNPs) representative of nuclear genetic lineage. Mitochondrial haplotype had a strong association with the ability of crabs to right themselves at 4.5°C that was sex specific: haplotypes originally from northern Europe gave male crabs an advantage while there was no haplotype effect on righting in female crabs. By contrast, the two nuclear SNPs that were significant outliers in a comparison between northern and southern C. maenas populations had no effect on righting response at low temperature. These results add C. maenas to the shortlist of ectotherms in which mitochondrial variation has been shown to affect thermal tolerance, and suggest that natural selection is shaping the structure of the hybrid zone across the Gulf of Maine. Our limited genomic sampling does not eliminate the strong possibility that mito-nuclear co-adaptation may play a role in the differences in thermal phenotypes documented here. Linkage between mitochondrial genotype and thermal tolerance suggests a role for local adaptation in promoting the spread of invasive populations of C. maenas around the world.

Date: 2006-03-01

Creator: Vladimir Douhovnikoff, Caterina Nerney, George K. Roderick, Craig H. Newton, Stephen C., Welter

Access: Open access

Nine microsatellite loci were isolated from the insect Dolichogenidea homoeosomae (Hymenoptera: Braconidae), an important parasitoid of the sunflower moth Homosoeosoma electellum (Lepidoptera: Pyralidae), and assayed for polymorphism. All nine loci were polymorphic within the five populations tested, with two to 14 alleles per locus. Expected and observed heterozygosities ranged from 0.39 to 0.90 and 0.25 to 0.72 respectively. These are the first microsatellite primers developed for D. homeosomae and will be useful for studies of population dynamics and connectivity. © 2006 Blackwell Publishing Ltd.

Date: 2004-01-01

Creator: Nissa L. Lohrmann, Barry A. Logan, Amy S. Johnson

Access: Open access

Mastocarpus stellatus and Chondrus crispus are red macroalgae that co-dominate the lower rocky intertidal zones of the northern Atlantic coast. M. stellatus is more tolerant than C. crispus of environmental stresses, particularly those experienced during winter. This difference in tolerance has been attributed, in part, to greater contents or activities of certain antioxidants in M. stellatus. We compared the photosynthetic capacities and activities of three antioxidant enzymes - superoxide dismutase (SOD), ascorbate peroxidase (APX), and glutathione reductase (GR) - as well as the contents of ascorbate from fronds of M. stellatus and C. crispus collected over a year. Photosynthetic capacity increased in winter, but did not differ between species in any season. The activities of the three antioxidant enzymes and the contents of ascorbate were significantly greater in tissues collected during months with mean air and water temperatures below 7.5°C ("cold" months; December, February, March, April) than in months with mean air temperatures above 11°C ("warm" months; June, July, August, October). Overall, C. crispus had significantly greater SOD and APX activities, while M. stellatus had higher ascorbate contents. Species-specific differences in GR activity depended upon mean monthly temperatures at the time of tissue collection; C. crispus had higher activities during cold months, whereas M. stellatus had higher activities during warm months. Taken together, these data indicate that increased ROS scavenging capacity is a part of winter acclimatization; however, only trends in ascorbate content support the hypothesis that greater levels of antioxidants underlie the relatively greater winter tolerance of M. stellatus in comparison to C. crispus.

Date: 1993-01-01

Creator: G. C. Trussell, A. S. Johnson, S. G. Rudolph, E. S. Gilfillan

Access: Open access

The authors quantified 1) shell size (defined as the maximum projected surface area, MPSA); 2) shell shape; 3) foot area; 4) maximum force to dislodge a snail in shear; and 5) tenacity (force per foot area required to dislodge) of the herbivorous Littorina obtusata. Wave-exposed snails were smaller (lower average MPSA), and were shorter and had larger foot area and greater dislodgement force than did protected snails of similar MPSA. The greater dislodgement force at the exposed site was due to larger foot area, not to greater tenacity. -from Authors

Date: 2020-05-01

Creator: Kevin C. Olsen, Will H. Ryan, Alice A. Winn, Ellen T. Kosman, Jose A., Moscoso, Stacy A. Krueger-Hadfield, Scott C. Burgess, David B. Carlon, Richard K. Grosberg, Susan Kalisz, Don R. Levitan

Access: Open access

Inbreeding is a potent evolutionary force shaping the distribution of genetic variation within and among populations of plants and animals. Yet, our understanding of the forces shaping the expression and evolution of nonrandom mating in general, and inbreeding in particular, remains remarkably incomplete. Most research on plant mating systems focuses on self-fertilization and its consequences for automatic selection, inbreeding depression, purging, and reproductive assurance, whereas studies of animal mating systems have often assumed that inbreeding is rare, and that natural selection favors traits that promote outbreeding. Given that many sessile and sedentary marine invertebrates and marine macroalgae share key life history features with seed plants (e.g., low mobility, modular construction, and the release of gametes into the environment), their mating systems may be similar. Here, we show that published estimates of inbreeding coefficients (FIS) for sessile and sedentary marine organisms are similar and at least as high as noted in terrestrial seed plants. We also found that variation in FIS within invertebrates is related to the potential to self-fertilize, disperse, and choose mates. The similarity of FIS for these organismal groups suggests that inbreeding could play a larger role in the evolution of sessile and sedentary marine organisms than is currently recognized. Specifically, associations between traits of marine invertebrates and FIS suggest that inbreeding could drive evolutionary transitions between hermaphroditism and separate sexes, direct development and multiphasic life cycles, and external and internal fertilization.

Date: 2014-10-01

Creator: Bitty A. Roy, Helen M. Alexander, Jennifer Davidson, Faith T. Campbell, Jeremy J., Burdon, Richard Sniezko, Clive Brasier

Access: Open access

Loss of forests due to non-native invasive pests (including insects, nematodes, and pathogens) is a global phenomenon with profound population, community, ecosystem, and economic impacts. We review the magnitude of pest-associated forest loss worldwide and discuss the major ecological and evolutionary causes and consequences of these invasions. After compiling and analyzing a dataset of pest invasions from 21 countries, we show that the number of forest pest invasions recorded for a given country has a significant positive relationship with trade (as indicated by gross domestic product) and is not associated with the amount of forested land within that country. We recommend revisions to existing international protocols for preventing pest entry and proliferation, including prohibiting shipments of non-essential plants and plant products unless quarantined. Because invasions often originate from taxa that are scientifically described only after their introduction, current phytosanitary regulations - which target specific, already named organisms - Are ineffective.

Date: 2008-11-01

Creator: Jack R. Bateman, C. Ting Wu

Access: Open access

Here we describe a simple method for generating donor vectors suitable for targeted transgenesis via recombinase-mediated cassette exchange (RMCE) using the ΦC31 integrase. This PCR-based strategy employs small attB "tails" on the primers used to amplify a sequence of interest, permitting the rapid creation of transgenes for in vivo analysis. Copyright © 2008 by the Genetics Society of America.

Date: 2021-09-01

Creator: Solymar Rolón-Martínez, Mohamed R. Habib, Tamer A. Mansour, Manuel Díaz-Ríos, Joshua J.C., Rosenthal, Xiao Nong Zhou, Roger P. Croll, Mark W. Miller

Access: Open access

Freshwater snails of the genus Biomphalaria serve as intermediate hosts for the digenetic trematode Schistosoma mansoni, the etiological agent for the most widespread form of intestinal schistosomiasis. As neuropeptide signaling in host snails can be altered by trematode infection, a neural transcriptomics approach was undertaken to identify peptide precursors in Biomphalaria glabrata, the major intermediate host for S. mansoni in the Western Hemisphere. Three transcripts that encode peptides belonging to the FMRF-NH2-related peptide (FaRP) family were identified in B. glabrata. One transcript encoded a precursor polypeptide (Bgl-FaRP1; 292 amino acids) that included eight copies of the tetrapeptide FMRF-NH2 and single copies of FIRF-NH2, FLRF-NH2, and pQFYRI-NH2. The second transcript encoded a precursor (Bgl-FaRP2; 347 amino acids) that comprised 14 copies of the heptapeptide GDPFLRF-NH2 and 1 copy of SKPYMRF-NH2. The precursor encoded by the third transcript (Bgl-FaRP3; 287 amino acids) recapitulated Bgl-FaRP2 but lacked the full SKPYMRF-NH2 peptide. The three precursors shared a common signal peptide, suggesting a genomic organization described previously in gastropods. Immunohistochemical studies were performed on the nervous systems of B. glabrata and B. alexandrina, a major intermediate host for S. mansoni in Egypt. FMRF-NH2-like immunoreactive (FMRF-NH2-li) neurons were located in regions of the central nervous system associated with reproduction, feeding, and cardiorespiration. Antisera raised against non-FMRF-NH2 peptides present in the tetrapeptide and heptapeptide precursors labeled independent subsets of the FMRF-NH2-li neurons. This study supports the participation of FMRF-NH2-related neuropeptides in the regulation of vital physiological and behavioral systems that are altered by parasitism in Biomphalaria.

Date: 2021-01-01

Creator: Andrew Moore

Access: Access restricted to the Bowdoin Community

• Embargo End Date: 2025-05-19

Date: 2022-01-01

Creator: Anthea L. Bell

Access: Embargoed

Date: 2012-08-27

Creator: Sonja A. Schwartz, Ann F. Budd, David B. Carlon

Access: Open access

Background: Even with well-known sampling biases, the fossil record is key to understanding macro-evolutionary patterns. During the Miocene to Pleistocene in the Caribbean Sea, the fossil record of scleractinian corals shows a remarkable period of rapid diversification followed by massive extinction. Here we combine a time-calibrated molecular phylogeny based on three nuclear introns with an updated fossil stratigraphy to examine patterns of radiation and extinction in Caribbean corals within the traditional family Faviidae. Results: Concatenated phylogenetic analysis showed most species of Caribbean faviids were monophyletic, with the exception of two Manicina species. The time-calibrated tree revealed the stem group originated around the closure of the Tethys Sea (17.0 Ma), while the genus Manicina diversified during the Late Miocene (8.20 Ma), when increased sedimentation and productivity may have favored free-living, heterotrophic species. Reef and shallow water specialists, represented by Diploria and Favia, originate at the beginning of the Pliocene (5 - 6 Ma) as the Isthmus of Panama shoaled and regional productivity declined. Conclusions: Later origination of the stem group than predicted from the fossil record corroborates the hypothesis of morphological convergence in Diploria and Favia genera. Our data support the rapid evolution of morphological and life-history traits among faviid corals that can be linked to Mio-Pliocene environmental changes. © 2012 Schwartz et al.; licensee BioMed Central Ltd.

Date: 2018-03-01

Creator: Andrew E. Christie, Alexandra Miller, Rebecca Fernandez, Evyn S. Dickinson, Audrey, Jordan, Jessica Kohn, Mina C. Youn, Patsy S. Dickinson

Access: Open access

The crustacean stomatogastric nervous system (STNS) is a well-known model for investigating neuropeptidergic control of rhythmic behavior. Among the peptides known to modulate the STNS are the C-type allatostatins (AST-Cs). In the lobster, Homarus americanus, three AST-Cs are known. Two of these, pQIRYHQCYFNPISCF (AST-C I) and GNGDGRLYWRCYFNAVSCF (AST-C III), have non-amidated C-termini, while the third, SYWKQCAFNAVSCFamide (AST-C II), is C-terminally amidated. Here, antibodies were generated against one of the non-amidated peptides (AST-C I) and against the amidated isoform (AST-C II). Specificity tests show that the AST-C I antibody cross-reacts with both AST-C I and AST-C III, but not AST-C II; the AST-C II antibody does not cross-react with either non-amidated peptide. Wholemount immunohistochemistry shows that both subclasses (non-amidated and amidated) of AST-C are distributed throughout the lobster STNS. Specifically, the antibody that cross-reacts with the two non-amidated peptides labels neuropil in the CoGs and the stomatogastric ganglion (STG), axons in the superior esophageal (son) and stomatogastric (stn) nerves, and ~ 14 somata in each commissural ganglion (CoG). The AST-C II-specific antibody labels neuropil in the CoGs, STG and at the junction of the sons and stn, axons in the sons and stn, ~ 42 somata in each CoG, and two somata in the STG. Double immunolabeling shows that, except for one soma in each CoG, the non-amidated and amidated peptides are present in distinct sets of neuronal profiles. The differential distributions of the two AST-C subclasses suggest that the two peptide groups are likely to serve different modulatory roles in the lobster STNS.

Date: 2012-07-01

Creator: Teerawat Wiwatpanit, Brian Powers, Patsy S. Dickinson

Access: Open access

Although the global effects of many modulators on pattern generators are relatively consistent among preparations, modulators can induce different alterations in different preparations. We examined the mechanisms that underlie such variability in the modulatory effects of the peptide C-type allatostatin (C-AST; pQIRYHQCYFNPISCF) on the cardiac neuromuscular system of the lobster Homarus americanus. Perfusion of C-AST through the semi-intact heart consistently decreased the frequency of ongoing contractions. However, the effect of C-AST on contraction amplitude varied between preparations, decreasing in some preparations and increasing in others. To investigate this variable effect, we examined the effects of C-AST both peripherally and centrally. When contractions of the myocardium were elicited by controlled stimuli, C-AST did not alter heart contraction at the periphery (myocardium or neuromuscular junction) in any hearts. However, when applied either to the semi-intact heart or to the cardiac ganglion (CG) isolated from hearts that responded to C-AST with increased contraction force, C-AST increased both motor neuron burst duration and the number of spikes per burst by about 25%. In contrast, CG output was increased only marginally in hearts that responded to C-AST with a decrease in contraction amplitude, suggesting that the decrease in amplitude in those preparations resulted from decreased peripheral facilitation. Our data suggest that the differential effects of a single peptide on the cardiac neuromuscular system are due solely to differential effects of the peptide on the pattern generator; the extent to which the peptide induces increased burst duration is crucial in determining its overall effect on the system. © 2012. Published by The Company of Biologists Ltd.

Date: 1995-12-01

Creator: Patsy S. Dickinson

Access: Open access

The stomatogastric nervous system of crustaceans, which controls the four parts ofthe foregut, is subject to modulation at all levels, sensory, central and motor. Modulation of the central pattern generators, which are themselves made up largely of motor neurons, providesfor increased behavioral flexibility in a variety of ways. First, each of the pattern generators can be reconfigured to give multiple outputs. Second, the "boundaries" of the different pattern generators are in fact somewhat fluid, so that the neuronal composition of the pattern generators can be altered. For example, neurons can switch from one pattern generator toanother, or two or more pattern generators can fuse to generate an entirely new pattern and thereby produce a new behavior. The mechanisms responsible for many of these modulations include alterations of both intrinsic properties and synaptic interactions between neurons. In addition, the alteration of membrane properties contributes more directly to the behavioral output by changing action potential frequency. Finally, the muscles of the stomatogastric system can themselves be modulated, with the cpvl muscle, for example, becoming an endogenous oscillator in the presence of either dopamine or the peptide FMRFamide. © 1995 by the American Society of Zoologists.

Date: 2013-05-06

Creator: Victor Zeng, Ben Ewen-Campen, Hadley W. Horch, Siegfried Roth, Taro, Mito, Cassandra G. Extavour

Access: Open access

Most genomic resources available for insects represent the Holometabola, which are insects that undergo complete metamorphosis like beetles and flies. In contrast, the Hemimetabola (direct developing insects), representing the basal branches of the insect tree, have very few genomic resources. We have therefore created a large and publicly available transcriptome for the hemimetabolous insect Gryllus bimaculatus (cricket), a well-developed laboratory model organism whose potential for functional genetic experiments is currently limited by the absence of genomic resources. cDNA was prepared using mRNA obtained from adult ovaries containing all stages of oogenesis, and from embryo samples on each day of embryogenesis. Using 454 Titanium pyrosequencing, we sequenced over four million raw reads, and assembled them into 21,512 isotigs (predicted transcripts) and 120,805 singletons with an average coverage per base pair of 51.3. We annotated the transcriptome manually for over 400 conserved genes involved in embryonic patterning, gametogenesis, and signaling pathways. BLAST comparison of the transcriptome against the NCBI non-redundant protein database (nr) identified significant similarity to nr sequences for 55.5% of transcriptome sequences, and suggested that the transcriptome may contain 19,874 unique transcripts. For predicted transcripts without significant similarity to known sequences, we assessed their similarity to other orthopteran sequences, and determined that these transcripts contain recognizable protein domains, largely of unknown function. We created a searchable, web-based database to allow public access to all raw, assembled and annotated data. This database is to our knowledge the largest de novo assembled and annotated transcriptome resource available for any hemimetabolous insect. We therefore anticipate that these data will contribute significantly to more effective and higher-throughput deployment of molecular analysis tools in Gryllus. © 2013 Zeng et al.

Date: 2016-12-01

Creator: Patsy S. Dickinson, Xuan Qu, Meredith E. Stanhope

Access: Open access

Central pattern generators are subject to modulation by peptides, allowing for flexibility in patterned output. Current techniques used to characterize peptides include mass spectrometry and transcriptomics. In recent years, hundreds of neuropeptides have been sequenced from crustaceans; mass spectrometry has been used to identify peptides and to determine their levels and locations, setting the stage for comparative studies investigating the physiological roles of peptides. Such studies suggest that there is some evolutionary conservation of function, but also divergence of function even within a species. With current baseline data, it should be possible to begin using comparative approaches to ask fundamental questions about why peptides are encoded the way that they are and how this affects nervous system function.

Date: 2014-05-01

Creator: Lauren A Skerritt

Access: Open access

In the American lobster (Homarus americanus), neurogenic stimulation of the heart drives fluxes of calcium (Ca2+) into the cytoplasm of a muscle cell resulting in heart muscle contraction. The heartbeat is completed by the active transport of calcium out of the cytoplasm into extracellular and intracellular spaces. An increase in the frequency of calcium release is expected to increase amplitude and duration of muscle contraction. This makes sense because an increase in cytoplasmic calcium should increase the activation of the muscle contractile elements (actin and myosin). Since calcium cycling is a reaction-diffusion process, the extent to which calcium mediates contraction amplitude and frequency will depend on the specific diffusion relationships of calcium in this system. Despite the importance of understanding this relationship, it is difficult to obtain experimental information on the dynamics of cytoplasmic calcium. Thus, we developed a mathematical diffusion model of the myofibril (muscle cell) to simulate calcium cycling in the lobster cardiac muscle cell. The amplitude and duration of the force curves produced by the model empirically mirrored that of the experimental data over a range of calcium diffusion coefficients (1-16), nerve stimulation durations (1/6-1/3 of a contraction period), and frequencies (40-80 Hz). The characteristics that alter the response of the lobster cardiac muscle system are stimulation duration (i.e., burst duration), burst frequency, and the rate of calcium diffusion into the cell’s cytoplasm. For this reason, we developed protocols that allow parameters representing these characteristics in the calcium-force model to be determined from isolated whole muscle experiments on lobster hearts (Phillips et al., 2004). These parameters are used to predict variability in lobster heart muscle function consistent with data recorded in experiments. Within the physiological range of nerve stimulation parameters (burst duration and cycle period), calcium increased the cell’s force output for increased burst duration. For example, increased duration of stimulation increased the muscle contraction period and vice versa. In terms of diffusion, a slower rate of calcium diffusion out of the sarcoplasmic reticulum decreased both the calcium level and the contraction duration of the cell. Finally, changes in stimulation frequency did not produce changes in contraction amplitude and duration. When considered in conjunction with experimental stimulations using lobster heart muscle cells, these data illustrate the prominent role for calcium diffusion in governing contraction-relaxation cycles in lobster hearts.

Date: 2002-03-14

Creator: Sandro R. Valentini, Jason M. Casolari, Carla C. Oliveira, Pamela A. Silver, Anne E., McBride

Access: Open access

The highly conserved eukaryotic translation initiation factor eIF5A has been proposed to have various roles in the cell, from translation to mRNA decay to nuclear protein export. To further our understanding of this essential protein, three temperature-sensitive alleles of the yeast TIF51A gene have been characterized. Two mutant eIF5A proteins contain mutations in a proline residue at the junction between the two eIFSA domains and the third, strongest allele encodes a protein with a single mutation in each domain, both of which are required for the growth defect. The stronger tif51A alleles cause defects in degradation of short-lived mRNAs, supporting a role for this protein in mRNA decay. A multicopy suppressor screen revealed six genes, the overexpression of which allows growth of a tif51A-1 strain at high temperature; these genes include PAB1, PKC1, and PKC1 regulators WSC1, WSC2, and WSC3. Further results suggest that eIFSA may also be involved in ribosomal synthesis and the WSC/PKC1 signaling pathway for cell wall integrity or related processes.

Date: 2004-08-15

Creator: Michael C. Yu, François Bachand, Anne E. McBride, Suzanne Komili, Jason M., Casolari, Pamela A. Silver

Access: Open access

Hmt1 is the major type I arginine methyltransferase in the yeast Saccharomyces cerevisiae and facilitates the nucleocytoplasmic transport of mRNA-binding proteins through their methylation. Here we demonstrate that Hmt1 is recruited during the beginning of the transcriptional elongation process. Hmt1 methylates Yra1 and Hrp1, two mRNA-binding proteins important for mRNA processing and export. Moreover, loss of Hmt1 affects interactions between mRNA-binding proteins and Tho2, a component of the TREX (transcription/export) complex that is important for transcriptional elongation and recruitment of mRNA export factors. Furthermore, RNA in situ hybridization analysis demonstrates that loss of Hmt1 results in slowed release of HSP104 mRNA from the sites of transcription. Genome-wide location analysis shows that Hmt1 is bound to specific functional gene classes, many of which are also bound by Tho2 and other mRNA-processing factors. These data suggest a model whereby Hmt1 affects transcriptional elongation and, as a result, influences recruitment of RNA-processing factors.

Date: 2021-01-01

Creator: Barry Logan

Access: Open access

Date: 2011-04-01

Creator: Hadley Wilson Horch, Elizabeth Sheldon, Claire C. Cutting, Claire R. Williams, Dana M., Riker, Hannah R. Peckler, Rohit B. Sangal

Access: Open access

The auditory system of the cricket has the unusual ability to respond to deafferentation by compensatory growth and synapse formation. Auditory interneurons such as ascending neuron 2 (AN-2) in the cricket Gryllus bimaculatus possess a dendritic arbor that normally grows up to, but not over, the midline of the prothoracic ganglion. After chronic deafferentation throughout larval development, however, the AN-2 dendritic arbor changes dramatically, and medial dendrites sprout across the midline where they form compensatory synapses with the auditory afferents from the contralateral ear. We quantified the extent of the effects of chronic, unilateral deafferentation by measuring several cellular parameters of 3 different neuronal components of the auditory system: the deafferented AN-2, the contralateral (or nondeafferented) AN-2 and the contralateral auditory afferents. Neuronal tracers and confocal microscopy were used to visualize neurons, and double-label experiments were performed to examine the cellular relationship between pairs of cells. Dendritic complexity was quantified using a modified Sholl analysis, and the length and volume of processes and presynaptic varicosities were assessed under control and deafferented conditions. Chronic deafferentation significantly influenced the morphology of all 3 neuronal components examined. The overall dendritic complexity of the deafferented AN-2 dendritic arbor was reduced, while both the contralateral AN-2 dendritic arbor and the remaining, intact, auditory afferents grew longer. We found no significant changes in the volume or density of varicosities after deafferentation. These complex cellular changes after deafferentation are interpreted in the light of the reported differential regulation of vesicle-associated membrane protein and semaphorin 2a. Copyright © 2011 S. Karger AG, Basel.

Date: 2015-04-01

Creator: Jeffrey C. Yu, Zachary D. Fox, James L. Crimp, Hana E. Littleford, Andrea L., Jowdry, William R. Jackman

Access: Open access

Intercellular communication by the hedgehog cell signaling pathway is necessary for tooth development throughout the vertebrates, but it remains unclear which specific developmental signals control cell behavior at different stages of odontogenesis. To address this issue, we have manipulated hedgehog activity during zebrafish tooth development and visualized the results using confocal microscopy. Results: We first established that reporter lines for dlx2b, fli1, NF-κB, and prdm1a are markers for specific subsets of tooth germ tissues. We then blocked hedgehog signaling with cyclopamine and observed a reduction or elimination of the cranial neural crest derived dental papilla, which normally contains the cells that later give rise to dentin-producing odontoblasts. Upon further investigation, we observed that the dental papilla begins to form and then regresses in the absence of hedgehog signaling, through a mechanism unrelated to cell proliferation or apoptosis. We also found evidence of an isometric reduction in tooth size that correlates with the time of earliest hedgehog inhibition. Conclusions: We hypothesize that these results reveal a previously uncharacterized function of hedgehog signaling during tooth morphogenesis, regulating the number of cells in the dental papilla and thereby controlling tooth size.

Date: 1998-05-07

Creator: Michael F. Palopoli, Nipam H. Patel

Access: Open access

Segmental identifies along the insect body depend on the activities of Hox genes [1,2]. In Drosophila melanogaster, one well-studied Hox regulatory target is Distal-less (DII), which Is required for the development of distel limb structures [3]. In abdominal segments, DII transcription is prevented when Hox proteins of the Bithorax Complex (BX-C) bind to cis-regulatory elements upstream of the DII transcription start site [4,5]. Previous evolutionary comparisons of gene expression patterns suggest that this direct repression is conserved between Diptera and Lepidoptera, but is absent in the Crustacea [6,7]. We examined gene expression patterns in three orders of hexapods, all of which develop abdominal appendages, in order to determine when the strong repressive interaction between BX-C proteins and DII appeared during evolution. In each of the species examined, DII expression was initiated in abdominal cells despite the presence of high levels of BX-C proteins. It appears that the strong repressive effects of BX-C proteins on DII expression arose relatively late in insect evolution. We suggest that the regulatory interaction between the BX-C genes and DII has evolved within the hexapods in a complex, segment-specific manner.

Date: 2004-01-01

Creator: Michael Butler, Amy S. Johnson

Access: Open access

Melanin has been associated with increased resistance to abrasion, decreased wear and lowered barb breakage in feathers. But, this association was inferred without considering barb position along the rachis as a potentially confounding variable. We examined the cross-sectional area, breaking force, breaking stress, breaking strain and toughness of melanized and unmelanized barbs along the entire rachis of a primary feather from an osprey (Pandion haliaetus). Although breaking force was higher for melanized barbs, breaking stress (force divided by cross-sectional area) was greater for unmelanized barbs. But when position was considered, all mechanical differences between melanized and unmelanized barbs disappeared. Barb breaking stress, breaking strain and toughness decreased, and breaking stiffness increased, distally along the rachis. These proximal-distal material property changes are small and seem unlikely to affect flight performance of barbs. Our observations of barb bending, breaking and morphology, however, lead us to propose a design principle for barbs. We propose that, by being thicker-walled dorso-ventrally, the barb's flexural stiffness is increased during flight; but, by allowing for twisting when loaded with dangerously high forces, barbs firstly avoid failure by bending and secondly avoid complete failure by buckling rather than rupturing.

Date: 1993-01-01

Creator: A. S. Johnson, K. P. Sebens

Access: Open access

Per polyp feeding rate was independent of the horizontal planform area of colonies. At the lowest velocities, most particles were captured on the upstream edge or in the middle of colonies, but all positional bias in capture rate disappeared at higher velocities. Particle capture and increasing flow speed were negatively associated. There were small, but measurable, differences in mean tentacle length between corals feeding at different velocities. Velocity-dependent feeding rate at most velocities was thus related to changes in flow rather than to changes in feeding behavior. Experiments in which corals were turned upside down revealed that the increased capture rate for rightside-up corals feeding at low velocity could be almost entirely accounted for by gravitational deposition of particles on the corals' tentacles. The tentacles form a canopy within which water movement was slowed, possibly facilitating gravitational deposition of non-buoyant or sinking food particles. -from Authors

Date: 1991-07-01

Creator: David L. Murray, Bruce D. Kohorn

Access: Open access

Date: 2020-03-01

Creator: Zoe M. Wood, Patricia L. Jones

Access: Open access

Philaenus spumarius (Meadow Spittlebug, Homoptera: Cercopoidea) is a cosmopolitan generalist insect that feeds on a wide repertoire of host plants in the field. We studied density and growth of Meadow Spittlebugs on a range of host plants on Kent Island, a boreal island in the Bay of Fundy, NB, Canada. The highest spittlebug densities were on Cirsium arvense (Canadian Thistle), although spittlebugs had larger body sizes on Solidago rugosa (Rough-stemmed Goldenrod) and Anaphalis margaritacea (Pearly Everlasting). We fertilized plots of Rough-stemmed Goldenrod in the field over 3 weeks to examine the effects of plant quality on development of Meadow Spittlebugs. Following fertilization, there were fewer nymphs present in fertilized plots than in unfertilized plots, indicating faster nymph maturation to adulthood on fertilized plants. This study offers an initial report of the host plants used by Meadow Spittlebugs in northeastern boreal habitat, variation in density and performance of the species on a range of host plants, and the effects of plant fertilization on spittlebug life history.

Date: 1983-01-01

Creator: B. D. Kohorn, P. M.M. Rae

Access: Open access

Date: 2006-01-24

Creator: Aimee M. Eldridge, Wayne A. Halsey, Deborah S. Wuttke

Access: Open access

The single-strand overhang present at telomeres plays a critical role in mediating both the capping and telomerase regulation functions of telomeres. The telomere end-binding proteins, Cdc13 in Saccharomyces cerevisiae, Pot1 in higher eukaryotes, and TEBP in the ciliated protozoan Oxytricha nova, exhibit sequence-specific binding to their respective single-strand overhangs. S. cerevisiae telomeres are composed of a heterogeneous mixture of GT-rich telomeric sequence, unlike in higher eukaryotes which have a simple repeat that is maintained with high fidelity. In yeast, the telomeric overhang is recognized by the essential protein Cdc13, which coordinates end-capping and telomerase activities at the telomere. The Cdc13 DNA-binding domain (Cdc13-DBD) binds these telomere sequences with high affinity (3 pM) and sequence specificity. To better understand the basis for this remarkable recognition, we have investigated the binding of the Cdc13-DBD to a series of altered DNA substrates. Although an 11-mer of GT-rich sequence is required for full binding affinity, only three of these 11 bases are recognized with high specificity. This specificity differs from that observed in the other known telomere end-binding proteins, but is well suited to the specific role of Cdc13 at yeast telomeres. These studies expand our understanding of telomere recognition by the Cdc13-DBD and of the unique molecular recognition properties of ssDNA binding. © 2006 American Chemical Society.

Date: 2007-09-01

Creator: Benjamin R. Williams, Jack R. Bateman, Natasha D. Novikov, C. Ting Wu

Access: Open access

Homolog pairing refers to the alignment and physical apposition of homologous chromosomal segments. Although commonly observed during meiosis, homolog pairing also occurs in nonmeiotic cells of several organisms, including humans and Drosophila. The mechanism underlying nonmeiotic pairing, however, remains largely unknown. Here, we explore the use of established Drosophila cell lines for the analysis of pairing in somatic cells. Using fluorescent in situ hybridization (FISH), we assayed pairing at nine regions scattered throughout the genome of Kc167 cells, observing high levels of homolog pairing at all six euchromatic regions assayed and variably lower levels in regions in or near centromeric heterochromatin. We have also observed extensive pairing in six additional cell lines representing different tissues of origin, different ploidies, and two different species, demonstrating homolog pairing in cell culture to be impervious to cell type or culture history. Furthermore, by sorting Kc167 cells into G1, S, and G2 subpopulations, we show that even progression through these stages of the cell cycle does not significantly change pairing levels. Finally, our data indicate that disrupting Drosophila topoisomerase II (Top2) gene function with RNAi and chemical inhibitors perturbs homolog pairing, suggesting Top2 to be a gene important for pairing. Copyright © 2007 by the Genetics Society of America.

Date: 2021-01-01

Creator: Hannah L. Randazzo

Access: Open access

Anthropogenic CO2 is changing the pCO2, temperature, and carbonate chemistry of seawater. These processes are termed ocean acidification (OA) and ocean warming. Previous studies suggest two opposing hypotheses for the way in which marine climate stress will influence echinoderm calcification, metabolic efficiency, and reproduction: either an additive or synergistic effect. Sea stars have a regenerative capacity, which may be particularly affected while rebuilding calcium carbonate arm structures, leading to changes in arm growth and calcification. In this study, Asterias forbesi were exposed to ocean water of either ambient, high temperature, high pCO2, or high temperature and high pCO2 for 60 days, and the regeneration length of the amputated arm was measured weekly. Ocean acidification conditions (pCO2 ~1180 μatm) had a negative impact on regenerated arm length, and an increase in temperature of +4°C above ambient conditions (Fall, Southern Gulf of Maine) had a positive effect on regenerated arm length, but the additive effects of these two factors resulted in smaller regenerated arms compared to ambient conditions. Sea stars regenerating under high pCO2 exhibited a lower proportion of calcified mass, which could be the result of a more energetically demanding calcification process associated with marine climate stress. These results indicate that A. forbesi calcification is sensitive to increasing pCO2, and that climate change will have an overall net negative effect on sea star arm regeneration. Such effects could translate into lower predation rates by a key consumer in the temperate rocky intertidal of North America.

Date: 2020-10-01

Creator: Emily R. Oleisky, Meredith E. Stanhope, J. Joe Hull, Andrew E. Christie, Patsy S., Dickinson

Access: Open access

The American lobster, Homarus americanus, cardiac neuromuscular system is controlled by the cardiac ganglion (CG), a central pattern generator consisting of four premotor and five motor neurons. Here, we show that the premotor and motor neurons can establish independent bursting patterns when decoupled by a physical ligature. We also show that mRNA encoding myosuppressin, a cardioactive neuropeptide, is produced within the CG. We thus asked whether myosuppressin modulates the decoupled premotor and motor neurons, and if so, how this modulation might underlie the role(s) that these neurons play in myosuppressin's effects on ganglionic output. Although myosuppressin exerted dose-dependent effects on burst frequency and duration in both premotor and motor neurons in the intact CG, its effects on the ligatured ganglion were more complex, with different effects and thresholds on the two types of neurons. These data suggest that the motor neurons are more important in determining the changes in frequency of the CG elicited by low concentrations of myosuppressin, whereas the premotor neurons have a greater impact on changes elicited in burst duration. A single putative myosuppressin receptor (MSR-I) was previously described from the Homarus nervous system. We identified four additional putative MSRs (MSR-II-V) and investigated their individual distributions in the CG premotor and motor neurons using RT-PCR. Transcripts for only three receptors (MSR-II-IV) were amplified from the CG. Potential differential distributions of the receptors were observed between the premotor and motor neurons; these differences may contribute to the distinct physiological responses of the two neuron types to myosuppressin. NEW & NOTEWORTHY Premotor and motor neurons of the Homarus americanus cardiac ganglion (CG) are normally electrically and chemically coupled, and generate rhythmic bursting that drives cardiac contractions; we show that they can establish independent bursting patterns when physically decoupled by a ligature. The neuropeptide myosuppressin modulates different aspects of the bursting pattern in these neuron types to determine the overall modulation of the intact CG. Differential distribution of myosuppressin receptors may underlie the observed responses to myosuppressin.

Date: 2013-10-22

Creator: Kristin M.K. Halbert, Erica Goetze, David B. Carlon

Access: Open access

Although holoplankton are ocean drifters and exhibit high dispersal potential, a number of studies on single species are finding highly divergent genetic clades. These cryptic species complexes are important to discover and describe, as identification of common marine species is fundamental to understanding ecosystem dynamics. Here we investigate the global diversity within Pleuromamma piseki and P. gracilis, two dominant members of the migratory zooplankton assemblage in subtropical and tropical waters worldwide. Using DNA sequence data from the mitochondrial gene cytochrome c oxidase subunit II (mtCOII) from 522 specimens collected across the Pacific, Atlantic and Indian Oceans, we discover twelve well-resolved genetically distinct clades in this species complex (Bayesian posterior probabilities >0.7; 6.3-17% genetic divergence between clades). The morphologically described species P. piseki and P. gracilis did not form monophyletic groups, rather they were distributed throughout the phylogeny and sometimes co-occurred within well-resolved clades: this result suggests that morphological characters currently used for taxonomic identification of P. gracilis and P. piseki may be inaccurate as indicators of species' boundaries. Cryptic clades within the species complex ranged from being common to rare, and from cosmopolitan to highly restricted in distribution across the global ocean. These novel lineages appear to be ecologically divergent, with distinct biogeographic distributions across varied pelagic habitats. We hypothesize that these mtDNA lineages are distinct species and suggest that resolving their systematic status is important, given the ecological significance of the genus Pleuromamma in subtropical-tropical waters worldwide. © 2013 Halbert et al.

Date: 2009-02-01

Creator: Patsy S. Dickinson, Elizabeth A. Stemmler, Elizabeth E. Barton, Christopher R. Cashman, Noah P., Gardner, Szymon Rus, Henry R. Brennan, Timothy S. McClintock, Andrew E. Christie

Access: Open access

Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans. © 2008 Elsevier Inc. All rights reserved.

Date: 2007-02-01

Creator: Andrew E. Christie, Kimberly K. Kutz-Naber, Elizabeth A. Stemmler, Alexandra Klein, Daniel I., Messinger, Christopher C. Goiney, Anna J. Conterato, Emily A. Bruns, Yun Wei A. Hsu, Lingjun Li, Patsy S. Dickinson

Access: Open access

Over a quarter of a century ago, Mykles described the presence of putative endocrine cells in the midgut epithelium of the crab Cancer magister (Mykles, 1979). In the years that have followed, these cells have been largely ignored and nothing is known about their hormone content or the functions they play in this species. Here, we used a combination of immunohistochemistry and mass spectrometric techniques to investigate these questions. Using immunohistochemistry, we identified both SIFamide-and tachykinin-related peptide (TRP)-like immunopositive cells in the midgut epithelium of C. magister, as well as in that of Cancer borealis and Cancer productus. In each species, the SIFamide-like labeling was restricted to the anterior portion of the midgut, including the paired anterior midgut caeca, whereas the TRP-like immunoreactivity predominated in the posterior midgut and the posterior midgut caecum. Regardless of location, label or species, the morphology of the immunopositive cells matched that of the putative endocrine cells characterized ultrastructurally by Mykles (Mykles, 1979). Matrix-assisted laser desorption/ ionization-Fourier transform mass spectrometry identified the peptides responsible for the immunoreactivities as GYRKPPFNGSIFamide (Gly 1-SIFamide) and APSGFLGMRamide [Cancer boreatis tachykinin-related peptide Ia (CabTRP Ia)], respectively, both of which are known neuropeptides of Cancer species. Although the function of these midgut-derived peptides remains unknown, we found that both Gly1-SIFamide and CabTRP Ia were released when the midgut was exposed to high-potassium saline. In addition, CabTRP Ia was detectable in the hemolymph of crabs that had been held without food for several days, but not in that of fed animals, paralleling results that were attributed to TRP release from midgut endocrine cells in insects. Thus, one function that midgut-derived CabTRP Ia may play in Cancer species is paracrine/hormonal control of feeding-related behavior, as has been postulated for TRPs released from homologous cells in insects.

Date: 1997-01-01

Creator: Patsy S. Dickinson, Wesley P. Fairfield, John R. Hetling, Jane Hauptman

Access: Open access

Two of the peptides found in the stomatogastric nervous system of the spiny lobster. Panulirus interruptus, interacted to modulate the activity of the cardiac sac motor pattern. In the isolated stomatogastric ganglion, red- pigment-concentrating hormone (RPCH), but not proctolin, activated the bursting activity in the inferior ventricular (IV) neurons that drives the cardiac sac pattern. The cardiac sac pattern normally ceased within 15 min after the end of RPCH superfusion. However, when proctolin was applied within a few minutes of that time, it was likewise able to induce cardiac sac activity. Similarly, proctolin applied together with subthreshold RPCH induced cardiac sac bursting. The amplitude of the excitatory postsynaptic potentials from the IV neurons to the cardiac sac dilator neuron CD2 (1 of the 2 major motor neurons in the cardiac sac system) was potentiated in the presence of both proctolin and RPCH. The potentiation in RPCH was much greater than in proctolin alone. However, the potentiation in proctolin after RPCH was equivalent to that recorded in RPCH alone. Although we do not yet understand the mechanisms for these interactions of the two modulators, this study provides an example of one factor that can determine the 'state' of the system that is critical in determining the effect of a modulator that is 'state dependent,' and it provides evidence for yet another level of flexibility in the motor output of this system.

Date: 2014-09-01

Creator: Vladimir Douhovnikoff, Eric L.G. Hazelton

Access: Open access

Premise of the study: The characteristics of clonal growth that are advantageous in invasive plants can also result in native plants’ ability to resist invasion. In Maine, we compared the clonal architecture and diversity of an invasive lineage (introduced Phragmites) and a noninvasive lineage (native Phragmites) present in much of North America. This study is the fi rst on standscale diversity using a sample size and systematic spatial-sampling scheme adequate for characterizing clonal structure in Phragmites. Our questions included: (1) Does the structure and extent of clonal growth suggest that the potential for clonal growth contributes to the invasiveness of the introduced lineage? (2) Is clonal growth common in the native lineage, acting as a possible source of ecological resistance and resilience?

Date: 1994-01-01

Creator: C. L. Borders, John A. Broadwater, Paula A. Bekeny, Johanna E. Salmon, Ann S., Lee, Aimee M. Eldridge, Virginia B. Pett

Access: Open access

We propose that arginine side chains often play a previously unappreciated general structural role in the maintenance of tertiary structure in proteins, wherein the positively charged guanidinium group forms multiple hydrogen bonds to backbone carbonyl oxygens. Using as a criterion for a “structural” arginine one that forms 4 or more hydrogen bonds to 3 or more backbone carbonyl oxygens, we have used molecular graphics to locate arginines of interest in 4 proteins: Arg 180 in Thermus thermophilus manganese superoxide dismutase, Arg 254 in human carbonic anhydrase II, Arg 31 in Streptomyces rubiginosus xylose isomerase, and Arg 313 in Rhodospirillum rubrum ribulose‐1,5‐bisphosphate carboxylase/oxygenase. Arg 180 helps to mold the active site channel of superoxide dismutase, whereas in each of the other enzymes the structural arginine is buried in the “mantle” (i.e., inside, but near the surface) of the protein interior well removed from the active site, where it makes 5 hydrogen bonds to 4 backbone carbonyl oxygens. Using a more relaxed criterion of 3 or more hydrogen bonds to 2 or more backbone carbonyl oxygens, arginines that play a potentially important structural role were found in yeast enolase, Bacillus stearothermophilus glyceraldehyde‐3‐phosphate dehydrogenase, bacteriophage T4 and human lysozymes, Enteromorpha prolifera plastocyanin, HIV‐1 protease, Trypanosoma brucei brucei and yeast triosephosphate isomerases, and Escherichia coli trp aporepressor (but not trp repressor or the trp repressor/operator complex). In addition to helping form the active site funnel in superoxide dismutase, the structural arginines found in this study play such diverse roles as stapling together 3 strands of backbone from different regions of the primary sequence, and tying α‐helix to α‐helix, βturn to β‐turn, and subunit to subunit. Copyright © 1994 The Protein Society

Date: 2010-11-01

Creator: Vladimir Douhovnikoff, Gregory R. Goldsmith, Ken D. Tape, Cherrie Huang, Nadine, Sur, M. Syndonia Bret-Harte

Access: Open access

Rapid climate change in arctic environments is leading to a widespread expansion in woody deciduous shrub populations. However, little is known about the reproductive, dispersal, and establishment mechanisms associated with shrub expansion. It is assumed that harsh environmental conditions impose limitations on plant sexual reproduction in the Arctic, such that population survival and expansion is predominately a function of clonal recruitment. We present contrary evidence from microsatellite genetic data suggesting the prevalence of recruitment by seed. Further, we present a conceptual model describing modes of recruitment in relation to the abiotic environment. Climate change may be alleviating abiotic stress so that resources are available for more frequent recruitment by seed. Such changes have widespread implications for ecosystem structure and functioning, including species composition, wildlife habitat, biogeochemical cycling, and surface energy balance. © 2010 Regents of the University of Colorado.

Date: 2015-05-01

Creator: Jackson F Bloch

Access: Open access

Nestling birds use begging calls to solicit resources from adults. Efficient transmission of calls is necessary for motivating parental feeding and outcompeting siblings. However, ambient acoustic masking and costs such as predation may influence the structure of the calls. While many interspecific comparisons of begging behavior have been made, the ontogeny of calls is understudied. In this study, Yellow Warbler (Setophaga petechia) begging calls were recorded and analyzed at different stages of nestling development to document changes in acoustic structure and gain insight into the selective forces that influence call development. Begging calls increased in peak frequency, frequency range, and amplitude during the 5-day recording period. Call duration did not change with age. Call structure did not differ between nestlings living in distinct acoustic environments. As begging calls increase in amplitude with age, perhaps due to increased food needs and competition from nestmates, nestlings may compensate for increased predation risk by increasing the peak frequency of the calls. Higher frequency calls attenuate more quickly than do low frequency calls and fall outside the frequency range of maximum hearing sensitivity for some potential predators. Previous studies on warbler begging have shown that nestlings of ground-nesting warblers, which are subject to higher rates of predation, beg at higher frequencies than do nestlings of tree-nesting warblers. This study supports the hypothesis that changes to begging call structure during development mirror the differences in call structure of species under different predation risks.

• Embargo End Date: 2028-05-18

Date: 2023-01-01

Creator: Olivia Bronzo-Munich

Access: Embargoed

Date: 2023-01-01

Creator: Kellie Navarro

Access: Open access

The coral Astrangia poculata inhabits hard-bottom environments from the Gulf of Mexico to Massachusetts and withstands large seasonal variation in temperature (–2 to 26 °C). This thermal range and its ability to live in a facultative symbiosis makes this species an ideal model system for investigating stress responses to ocean temperature variation. Although it has been shown that aposymbiotic A. poculata upregulates more genes in response to cold stress than heat stress, the transcriptomic response of the holobiont (coral host and symbiotic algae) to stress is unknown. In this study, we characterize changes in gene expression in both the host and symbionts under cold stress (6ºC) and ambient (12ºC) seawater temperatures. We use RNAseq to visualize how patterns of global gene expression change in response to these temperatures within the transcriptomes of replicate corals (n=10, each temperature) and their symbiont partners. By filtering the holobiont assembly for known coral host and symbiont genes, we contrasted patterns of differential expression (DE) for each partner and the functional processes for each set of DE genes. Differential gene expression analyses revealed that the cnidarian coral host responds strongly to cold stress, while algal symbionts did not have a significant stress response. In the coral host, we found up-regulation of biological processes associated with DNA repair, immunity, and maintaining cellular homeostasis as well as downregulation of mechanisms associated with DNA repair and RNA splicing, indicating inhibition of necessary cellular processes due to environmental stress.

Date: 2023-01-01

Creator: Nuoya (Laura) Yang

Access: Access restricted to the Bowdoin Community

Date: 2025-01-01

Creator: Matthew Joseph Morales

Access: Access restricted to the Bowdoin Community

Date: 2000-01-01

Creator: Nalini M. Nadkarni, Nathaniel T. Wheelwright

Access: Open access

The Monteverde Cloud Forest Reserve has captured the worldwide attention of biologists, conservationists, and ecologists and has been the setting for extensive investigation over the past 40 years. Roughly 40,000 ecotourists visit the Cloud Forest each year, and it is often considered the archetypal high-altitude rain forest. Featuring synthetic chapters and specific accounts written by more than 100 biologists and local residents, the 573-page book documents in a single volume everything known about the biological diversity of Monteverde, Costa Rica, and how to protect it. New short chapters which update and expand the research presented in the 2000 Oxford publication were written in 2014 and are now available.

Date: 2009-08-01

Creator: H. W. Horch, S. S. McCarthy, S. L. Johansen, J. M. Harris

Access: Open access

Neurones that lose their presynaptic partners because of injury usually retract or die. However, when the auditory interneurones of the cricket Gryllus bimaculatus are denervated, dendrites respond by growing across the midline and forming novel synapses with the opposite auditory afferents. Suppression subtractive hybridization was used to detect transcriptional changes 3 days after denervation. This is a stage at which we demonstrate robust compensatory dendritic sprouting. Whereas 49 unique candidates were down-regulated, no sufficiently up-regulated candidates were identified at this time point. Several candidates identified in this study are known to influence the translation and degradation of proteins in other systems. The potential role of these factors in the compensatory sprouting of cricket auditory interneurones in response to denervation is discussed. © 2009 The Royal Entomological Society.

Date: 2011-01-01

Creator: J. Lichter, M.E.H. Burton, S.L. Close, J.M. Grinvalsky, J., Reblin

Access: Open access

Date: 2015-12-29

Creator: Michael F. Palopoli, Daniel J. Fergus, Samuel Minot, Dorothy T. Pei, W. Brian, Simison, Iria Fernandez-Silva, Megan S. Thoemmes, Robert R. Dunn, Michelle Trautwein

Access: Open access

Microscopic mites of the genus Demodex live within the hair follicles of mammals and are ubiquitous symbionts of humans, but little molecular work has been done to understand their genetic diversity or transmission. Here we sampled mite DNA from 70 human hosts of diverse geographic ancestries and analyzed 241 sequences from the mitochondrial genome of the species Demodex folliculorum. Phylogenetic analyses recovered multiple deep lineages including a globally distributed lineage common among hosts of European ancestry and three lineages that primarily include hosts of Asian, African, and Latin American ancestry. To a great extent, the ancestral geography of hosts predicted the lineages of mites found on them; 27% of the total molecular variance segregated according to the regional ancestries of hosts. We found that D. folliculorum populations are stable on an individual over the course of years and that some Asian and African American hosts maintain specific mite lineages over the course of years or generations outside their geographic region of birth or ancestry. D. folliculorum haplotypes were much more likely to be shared within families and between spouses than between unrelated individuals, indicating that transmission requires close contact. Dating analyses indicated that D. folliculorum origins may predate modern humans. Overall, D. folliculorum evolution reflects ancient human population divergences, is consistent with an out-of-Africa dispersal hypothesis, and presents an excellent model system for further understanding the history of human movement.

Date: 2004-10-01

Creator: William R. Jackman, Bruce W. Draper, David W. Stock

Access: Open access

We have investigated fibroblast growth factor (FGF) signaling during the development of the zebrafish pharyngeal dentition with the goal of uncovering novel roles for FGFs in tooth development as well as phylogenetic and topographic diversity in the tooth developmental pathway. We found that the tooth-related expression of several zebrafish genes is similar to that of their mouse orthologs, including both epithelial and mesenchymal markers. Additionally, significant differences in gene expression between zebrafish and mouse teeth are indicated by the apparent lack of fgf8 and pax9 expression in zebrafish tooth germs. FGF receptor inhibition with SU5402 at 32 h blocked dental epithelial morphogenesis and tooth mineralization. While the pharyngeal epithelium remained intact as judged by normal pitx2 expression, not only was the mesenchymal expression of lhx6 and lhx7 eliminated as expected from mouse studies, but the epithelial expression of dlx2a, dlx2b, fgf3, and fgf4 was as well. This latter result provides novel evidence that the dental epithelium is a target of FGF signaling. However, the failure of SU5402 to block localized expression of pitx2 suggests that the earliest steps of tooth initiation are FGF-independent. Investigations of specific FGF ligands with morpholino antisense oligonucleotides revealed only a mild tooth shape phenotype following fgf4 knockdown, while fgf8 inhibition revealed only a subtle down-regulation of dental dlx2b expression with no apparent effect on tooth morphology. Our results suggest redundant FGF signals target the dental epithelium and together are required for dental morphogenesis. Further work will be required to elucidate the nature of these signals, particularly with respect to their origins and whether they act through the mesenchyme. © 2004 Elsevier Inc. All rights reserved.

Date: 2019-01-01

Creator: Katherine Tian, Rachel E. Henderson, Reyna Parker, Alexia Brown, Justine E., Johnson, Jack R. Bateman

Access: Open access

For many genes, proper gene expression requires coordinated and dynamic interactions between multiple regulatory elements, each of which can either promote or silence transcription. In Drosophila, the complexity of the regulatory landscape is further complicated by the tight physical pairing of homologous chromosomes, which can permit regulatory elements to interact in trans, a phenomenon known as transvection. To better understand how gene expression can be programmed through cis- and trans-regulatory interactions, we analyzed transvection effects for a collection of alleles of the eyes absent (eya) gene. We find that trans-activation of a promoter by the eya eye-specific enhancers is broadly supported in many allelic backgrounds, and that the availability of an enhancer to act in trans can be predicted based on the molecular lesion of an eya allele. Furthermore, by manipulating promoter availability in cis and in trans, we demonstrate that the eye-specific enhancers of eya show plasticity in their promoter preference between two different transcriptional start sites, which depends on promoter competition between the two potential targets. Finally, we show that certain alleles of eya demonstrate pairing-sensitive silencing resulting from trans-interactions between Polycomb Response Elements (PREs), and genetic and genomic data support a general role for PcG proteins in mediating transcriptional silencing at eya. Overall, our data highlight how eya gene regulation relies upon a complex but plastic interplay between multiple enhancers, promoters, and PREs.