Showing 2001 - 2050 of 5831 Items
Alongside Despair: Signs of Life on the River des Peres
Date: 2020-01-01
Creator: Marina Henke
Access: Open access
- This River des Peres is a partially enclosed river which runs through St. Louis, Missouri. Used since prior to the city’s founding, the des Peres has gone through two considerable engineering projects: one in 1901 in light of the World’s Fair, and one in 1923, which encapsulated more than half of the river and placed nearly five miles of it underground. Presently, the des Peres constitutes the backbone of the sanitary and sewer system of St. Louis city and county. Ultimately, the river offers a broad meditation on what it means to live around and in a “natural” waterway that is simultaneously not natural at all. Themes of St. Louis are equally reflected in the river: of environmental racism, of Midwestern decline, and of urban decay and renewal. Additionally, those who interact with the river prove a broad cast of characters. Through using a selection of interviews with locals, alongside an engagement with the work of contemporary poet Donald Finkel, this piece of creative nonfiction explores the multiplicity, and ultimately the value, of distorted natural spaces.
Localization of DNA sequences promoting RNA polymerase I activity in Drosophila
Date: 1983-01-01
Creator: B. D. Kohorn, P. M.M. Rae
Access: Open access
Resonance in the menstrual cycle: A new model of the LH surge
Date: 2003-01-01
Creator: Mary Lou Zeeman, W. Weckesser, D. Gokhman
Access: Open access
- In vertebrates, ovulation is triggered by a surge of LH from the pituitary. The precise mechanism by which rising oestradiol concentrations initiate the LH surge in the human menstrual cycle remains a fundamental open question of reproductive biology. It is well known that sampling of serum LH on a time scale of minutes reveals pulsatile release from the pituitary in response to pulses of gonadotrophin releasing hormone from the hypothalamus. The LH pulse frequency and amplitude vary considerably over the cycle, with the highest frequency and amplitude at the midcycle surge. Here a new mathematical model is presented of the pituitary as a damped oscillator (pulse generator) driven by the hypothalamus. The model LH surge is consistent with LH data on the time scales of both minutes and days. The model is used to explain the surprising pulse frequency characteristics required to treat human infertility disorders such as Kallmann's syndrome, and new experimental predictions are made.
Extinction in nonautonomous competitive Lotka-Volterra Systems
Date: 1996-01-01
Creator: Francisco Montes De Oca, Mary Lou Zeeman
Access: Open access
- It is well known that for the two species autonomous competitive Lotka-Volterra model with no fixed point in the open positive quadrant, one of the species is driven to extinction, whilst the other population stabilises at its own carrying capacity. In this paper we prove a generalisation of this result to nonautonomous systems of arbitrary finite dimension. That is, for the n species nonautonomous competitive Lotka-Volterra model, we exhibit simple algebraic criteria on the parameters which guarantee that all but one of the species is driven to extinction. The restriction of the system to the remaining axis is a nonautonomous logistic equation, which has a unique solution u(t) that is strictly positive and bounded for all time; see Coleman (Math. Biosci. 45 (1979), 159-173) and Ahmad (Proc. Amer. Math. Soc. 117 (1993), 199-205). We prove in addition that all solutions of the n-dimensional system with strictly positive initial conditions are asymptotic to u(t). © 1996 American Mathematical Society.
Non-genomic effects of steroids on teleost fish olfaction: behavioral and anatomical approaches Access to this record is restricted to members of the Bowdoin community. Log in here to view.
Date: 2020-01-01
Creator: Leah B Kratochvil
Access: Access restricted to the Bowdoin Community
Identification of the determinants for the specific recognition of single-strand telomeric DNA by Cdc13
Date: 2006-01-24
Creator: Aimee M. Eldridge, Wayne A. Halsey, Deborah S. Wuttke
Access: Open access
- The single-strand overhang present at telomeres plays a critical role in mediating both the capping and telomerase regulation functions of telomeres. The telomere end-binding proteins, Cdc13 in Saccharomyces cerevisiae, Pot1 in higher eukaryotes, and TEBP in the ciliated protozoan Oxytricha nova, exhibit sequence-specific binding to their respective single-strand overhangs. S. cerevisiae telomeres are composed of a heterogeneous mixture of GT-rich telomeric sequence, unlike in higher eukaryotes which have a simple repeat that is maintained with high fidelity. In yeast, the telomeric overhang is recognized by the essential protein Cdc13, which coordinates end-capping and telomerase activities at the telomere. The Cdc13 DNA-binding domain (Cdc13-DBD) binds these telomere sequences with high affinity (3 pM) and sequence specificity. To better understand the basis for this remarkable recognition, we have investigated the binding of the Cdc13-DBD to a series of altered DNA substrates. Although an 11-mer of GT-rich sequence is required for full binding affinity, only three of these 11 bases are recognized with high specificity. This specificity differs from that observed in the other known telomere end-binding proteins, but is well suited to the specific role of Cdc13 at yeast telomeres. These studies expand our understanding of telomere recognition by the Cdc13-DBD and of the unique molecular recognition properties of ssDNA binding. © 2006 American Chemical Society.
Disruption of topoisomerase II perturbs pairing in Drosophila cell culture
Date: 2007-09-01
Creator: Benjamin R. Williams, Jack R. Bateman, Natasha D. Novikov, C. Ting Wu
Access: Open access
- Homolog pairing refers to the alignment and physical apposition of homologous chromosomal segments. Although commonly observed during meiosis, homolog pairing also occurs in nonmeiotic cells of several organisms, including humans and Drosophila. The mechanism underlying nonmeiotic pairing, however, remains largely unknown. Here, we explore the use of established Drosophila cell lines for the analysis of pairing in somatic cells. Using fluorescent in situ hybridization (FISH), we assayed pairing at nine regions scattered throughout the genome of Kc167 cells, observing high levels of homolog pairing at all six euchromatic regions assayed and variably lower levels in regions in or near centromeric heterochromatin. We have also observed extensive pairing in six additional cell lines representing different tissues of origin, different ploidies, and two different species, demonstrating homolog pairing in cell culture to be impervious to cell type or culture history. Furthermore, by sorting Kc167 cells into G1, S, and G2 subpopulations, we show that even progression through these stages of the cell cycle does not significantly change pairing levels. Finally, our data indicate that disrupting Drosophila topoisomerase II (Top2) gene function with RNAi and chemical inhibitors perturbs homolog pairing, suggesting Top2 to be a gene important for pairing. Copyright © 2007 by the Genetics Society of America.
Wnt Signaling is Dispensable to Formation of the First Tooth in D. Rerio This record is embargoed.
- Embargo End Date: 2025-05-14
Date: 2020-01-01
Creator: Zachary C. LeBlanc
Access: Embargoed
Bowdoin College Catalogue (1922-1923)
Date: 1923-01-01
Access: Open access
- Bowdoin College Bulletin no. 122
Haplotype mapping of a diploid non-meiotic organism using existing and induced aneuploidies
Date: 2008-01-01
Creator: Melanie Legrand, Anja Forche, Anna Selmecki, Christine Chan, David T., Kirkpatrick, Judith Berman
Access: Open access
- Haplotype maps (HapMaps) reveal underlying sequence variation and facilitate the study of recombination and genetic diversity. In general, HapMaps are produced by analysis of Single-Nucleotide Polymorphism (SNP) segregation in large numbers of meiotic progeny. Candida albicans, the most common human fungal pathogen, is an obligate diploid that does not appear to undergo meiosis. Thus, standard methods for haplotype mapping cannot be used. We exploited naturally occurring aneuploid strains to determine the haplotypes of the eight chromosome pairs in the C. albicans laboratory strain SC5314 and in a clinical isolate. Comparison of the maps revealed that the clinical strain had undergone a significant amount of genome rearrangement, consisting primarily of crossover or gene conversion recombination events. SNP map haplotyping revealed that insertion and activation of the UAU1 cassette in essential and non-essential genes can result in whole chromosome aneuploidy. UAU1 is often used to construct homozygous deletions of targeted genes in C. albicans; the exact mechanism (trisomy followed by chromosome loss versus gene conversion) has not been determined. UAU1 insertion into the essential ORC1 gene resulted in a large proportion of trisomic strains, while gene conversion events predominated when UAU1 was inserted into the non-essential LRO1 gene. Therefore, induced aneuploidies can be used to generate HapMaps, which are essential for analyzing genome alterations and mitotic recombination events in this clonal organism. © 2008 Legrand et al.
Spending Fast and Furious: Political Advertising in 2020
Date: 2021-03-01
Creator: Travis N. Ridout, Erika Franklin Fowler, Michael M. Franz
Access: Open access
- This article is a "first look"at political advertising in 2020. Spending on political advertising in the United States in 2020 obliterated records, and Democrats held huge advantages in the presidential race and in most congressional and senatorial races. In addition, all indicators suggest that spending on digital advertising continued to rise. Political advertising was largely similar in tone to past years and, in the presidential race, was substantially more positive than 2016. In addition, interest groups remained heavily involved in federal races in 2020, airing more ads than ever before, though their spending as a percentage of total ad spending was slightly less than in 2016. Political ad spending in 2020 may have been historically high because of the impact of COVID-19 on how campaigns could reach voters, suggesting that paid advertising may decline in 2022 and 2024, at least as a percentage of total election spending.
Tapping at the Windows: A Collection This record is embargoed.
- Embargo End Date: 2025-05-14
Date: 2020-01-01
Creator: Samuel Milligan
Access: Embargoed
Performing Sor Juana: Reimagining a Mexican Literary Figure in the 21st Century
Date: 2020-01-01
Creator: Uriel López-Serrano
Access: Open access
- Sor Juana Inés de la Cruz (c. 1648-1695) was a Mexican nun, poet, playwright, and scholar from the colonial era. She has become an icon for various global, social, and political movements. This project looks at four dramatic works created by Sorjuanistas who reimagine Sor Juana’s story for contemporary audiences living in the United States. The works included in this essay are Estela Portillo-Trambley’s Sor Juana (1986), Karen Zacarías’s The Sins of Sor Juana (2001), and Alicia Gaspar de Alba’s “Interview with Sor Juana Inés de la Cruz” (1998/2014) and her newest work, Juana: An Opera in Two Acts (2019), libretto by Carla Lucero. In addition to reimagining Sor Juana’s story, these dramatic works expose the sexism, racism, and xenophobia perpetuated by U.S institutions of power that discriminate against Latin@ and Chican@ individuals. By shedding light on the social injustices that existed during the colonial era, an embodied Sor Juana teaches audiences how to resist and mobilize against such oppressive powers. Sor Juana’s narrative on stage is necessary because she is a role model for Latin@s/Chican@s. Sorjuanistas remind us that the body can be used to retell the narratives of the silenced individuals who are victims of oppression. By developing heritage performances, Sorjuanistas challenge histories that silence and overlook social injustices. Witnessing Sor Juana on stage triggers emotional responses to the past which allow historical actors to obtain intellectual, emotional, and political agency in an effort to affirm and remember particular contemporary and future commitments to fighting social injustices.
Do Infant Temperament Characteristics Predict Core Academic Abilities in Preschool-Aged Children?
Date: 2016-01-01
Creator: Maria A. Gartstein, Samuel P. Putnam, Rachel Kliewer
Access: Open access
- Examined relationships between temperament, measured via parent report at 4 months and structured laboratory observations at 12 months of age, and a school readiness battery administered at about 4 years of age (N =31). Scores on the School Readiness Assessment of the Bracken Basic Concept Scale (BBCS) were related to infant Positive Affectivity/Surgency (PAS), with infants described as demonstrating higher levels of PAS at 4 months of age later demonstrating greater school readiness in the domains of color, letter, and number skills. Regulatory Capacity/Orienting (RCO) at 4 months also predicted color skills, with more regulated infants demonstrating superior pre-academic functioning in this area. Analyses involving laboratory observations of temperament provided additional information concerning the importance of infant Positive Affectivity/Surgency, predictive of letter skills and overall school-readiness scores later in childhood. Results are discussed in the context of implications for theory and research, as well as early education settings.
Event-related potential correlates of interference effects on recognition memory
Date: 2008-02-01
Creator: Kenneth A. Norman, Katharine Tepe, Erika Nyhus, Tim Curran
Access: Open access
- The question of interference (how new learning affects previously acquired knowledge and vice versa) is a central theoretical issue in episodic memory research, but very few human neuroimaging studies have addressed this question. Here, we used event-related potentials (ERPs) to test the predictions of the complementary learning systems (CLS) model regarding how list strength manipulations (strengthening some, but not all, items on a study list) affect recognition memory. Our analysis focused on the FN400 old-new effect, a hypothesized ERP correlate of familiarity-based recognition, and the parietal old-new effect, a hypothesized ERP correlate of recollection-based recognition. As is predicted by the CLS model, increasing list strength selectively reduced the ERP correlate of recollection-based discrimination, leaving the ERP correlate of familiarity-based discrimination intact. In a second experiment, we obtained converging evidence for the CLS model's predictions, using a remember/know test: Increasing list strength reduced recollection-based discrimination but did not reduce familiarity-based discrimination. Copyright 2008 Psychonomic Society, Inc.
Components of the Springer fiber and domino tableaux
Date: 2004-02-15
Creator: Thomas Pietraho
Access: Open access
- Consider a complex classical semisimple Lie group along with the set of its nilpotent coadjoint orbits. When the group is of type A, the set of orbital varieties contained in a given nilpotent orbit is described a set of standard Young tableaux. We parameterize both, the orbital varieties and the irreducible components of unipotent varieties in the other classical groups by sets of standard domino tableaux. The main tools are Spaltenstein's results on signed domino tableaux together with Garfinkle's operations on standard domino tableaux. © 2004 Elsevier Inc. All rights reserved.
An Analysis of Hezbollah’s Media Platforms, Focusing on Themes, Narratives and Strategy Access to this record is restricted to members of the Bowdoin community. Log in here to view.
- Restriction End Date: 2025-06-01
Date: 2020-01-01
Creator: Nichole Irving
Access: Access restricted to the Bowdoin Community
Noninvasive Memory Modulation Via Targeted Theta TACS Entrainment of the Frontoparietal Network Access to this record is restricted to members of the Bowdoin community. Log in here to view.
- Restriction End Date: 2026-06-01
Date: 2021-01-01
Creator: Brandon S Lee
Access: Access restricted to the Bowdoin Community
Down in arms: Marine climate stress inhibits growth and calcification of regenerating Asterias forbesi (Echinodermata: Asteroidea) arms
Date: 2021-01-01
Creator: Hannah L. Randazzo
Access: Open access
- Anthropogenic CO2 is changing the pCO2, temperature, and carbonate chemistry of seawater. These processes are termed ocean acidification (OA) and ocean warming. Previous studies suggest two opposing hypotheses for the way in which marine climate stress will influence echinoderm calcification, metabolic efficiency, and reproduction: either an additive or synergistic effect. Sea stars have a regenerative capacity, which may be particularly affected while rebuilding calcium carbonate arm structures, leading to changes in arm growth and calcification. In this study, Asterias forbesi were exposed to ocean water of either ambient, high temperature, high pCO2, or high temperature and high pCO2 for 60 days, and the regeneration length of the amputated arm was measured weekly. Ocean acidification conditions (pCO2 ~1180 μatm) had a negative impact on regenerated arm length, and an increase in temperature of +4°C above ambient conditions (Fall, Southern Gulf of Maine) had a positive effect on regenerated arm length, but the additive effects of these two factors resulted in smaller regenerated arms compared to ambient conditions. Sea stars regenerating under high pCO2 exhibited a lower proportion of calcified mass, which could be the result of a more energetically demanding calcification process associated with marine climate stress. These results indicate that A. forbesi calcification is sensitive to increasing pCO2, and that climate change will have an overall net negative effect on sea star arm regeneration. Such effects could translate into lower predation rates by a key consumer in the temperate rocky intertidal of North America.
Bowdoin College Catalogue (1941-1942)
Date: 1942-01-01
Access: Open access
- Bowdoin College Bulletin no. 260
Differential neuropeptide modulation of premotor and motor neurons in the lobster cardiac ganglion
Date: 2020-10-01
Creator: Emily R. Oleisky, Meredith E. Stanhope, J. Joe Hull, Andrew E. Christie, Patsy S., Dickinson
Access: Open access
- The American lobster, Homarus americanus, cardiac neuromuscular system is controlled by the cardiac ganglion (CG), a central pattern generator consisting of four premotor and five motor neurons. Here, we show that the premotor and motor neurons can establish independent bursting patterns when decoupled by a physical ligature. We also show that mRNA encoding myosuppressin, a cardioactive neuropeptide, is produced within the CG. We thus asked whether myosuppressin modulates the decoupled premotor and motor neurons, and if so, how this modulation might underlie the role(s) that these neurons play in myosuppressin's effects on ganglionic output. Although myosuppressin exerted dose-dependent effects on burst frequency and duration in both premotor and motor neurons in the intact CG, its effects on the ligatured ganglion were more complex, with different effects and thresholds on the two types of neurons. These data suggest that the motor neurons are more important in determining the changes in frequency of the CG elicited by low concentrations of myosuppressin, whereas the premotor neurons have a greater impact on changes elicited in burst duration. A single putative myosuppressin receptor (MSR-I) was previously described from the Homarus nervous system. We identified four additional putative MSRs (MSR-II-V) and investigated their individual distributions in the CG premotor and motor neurons using RT-PCR. Transcripts for only three receptors (MSR-II-IV) were amplified from the CG. Potential differential distributions of the receptors were observed between the premotor and motor neurons; these differences may contribute to the distinct physiological responses of the two neuron types to myosuppressin. NEW & NOTEWORTHY Premotor and motor neurons of the Homarus americanus cardiac ganglion (CG) are normally electrically and chemically coupled, and generate rhythmic bursting that drives cardiac contractions; we show that they can establish independent bursting patterns when physically decoupled by a ligature. The neuropeptide myosuppressin modulates different aspects of the bursting pattern in these neuron types to determine the overall modulation of the intact CG. Differential distribution of myosuppressin receptors may underlie the observed responses to myosuppressin.
High Cryptic Diversity across the Global Range of the Migratory Planktonic Copepods Pleuromamma piseki and P. gracilis
Date: 2013-10-22
Creator: Kristin M.K. Halbert, Erica Goetze, David B. Carlon
Access: Open access
- Although holoplankton are ocean drifters and exhibit high dispersal potential, a number of studies on single species are finding highly divergent genetic clades. These cryptic species complexes are important to discover and describe, as identification of common marine species is fundamental to understanding ecosystem dynamics. Here we investigate the global diversity within Pleuromamma piseki and P. gracilis, two dominant members of the migratory zooplankton assemblage in subtropical and tropical waters worldwide. Using DNA sequence data from the mitochondrial gene cytochrome c oxidase subunit II (mtCOII) from 522 specimens collected across the Pacific, Atlantic and Indian Oceans, we discover twelve well-resolved genetically distinct clades in this species complex (Bayesian posterior probabilities >0.7; 6.3-17% genetic divergence between clades). The morphologically described species P. piseki and P. gracilis did not form monophyletic groups, rather they were distributed throughout the phylogeny and sometimes co-occurred within well-resolved clades: this result suggests that morphological characters currently used for taxonomic identification of P. gracilis and P. piseki may be inaccurate as indicators of species' boundaries. Cryptic clades within the species complex ranged from being common to rare, and from cosmopolitan to highly restricted in distribution across the global ocean. These novel lineages appear to be ecologically divergent, with distinct biogeographic distributions across varied pelagic habitats. We hypothesize that these mtDNA lineages are distinct species and suggest that resolving their systematic status is important, given the ecological significance of the genus Pleuromamma in subtropical-tropical waters worldwide. © 2013 Halbert et al.
Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii
Date: 2009-02-01
Creator: Patsy S. Dickinson, Elizabeth A. Stemmler, Elizabeth E. Barton, Christopher R. Cashman, Noah P., Gardner, Szymon Rus, Henry R. Brennan, Timothy S. McClintock, Andrew E. Christie
Access: Open access
- Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans. © 2008 Elsevier Inc. All rights reserved.
Bowdoin College Catalogue (1959-1960)
Date: 1960-01-01
Access: Open access
- Bowdoin College Bulletin no. 334
Midgut epithelial endocrine cells are a rich source of the neuropeptides APSGFLGMRamide (Cancer borealis tachykinin-related peptide Ia) and GYRKPPFNGSIFamide (Gly1-SIFamide) in the crabs Cancer borealis, Cancer magister and Cancer productus
Date: 2007-02-01
Creator: Andrew E. Christie, Kimberly K. Kutz-Naber, Elizabeth A. Stemmler, Alexandra Klein, Daniel I., Messinger, Christopher C. Goiney, Anna J. Conterato, Emily A. Bruns, Yun Wei A. Hsu, Lingjun Li, Patsy S. Dickinson
Access: Open access
- Over a quarter of a century ago, Mykles described the presence of putative endocrine cells in the midgut epithelium of the crab Cancer magister (Mykles, 1979). In the years that have followed, these cells have been largely ignored and nothing is known about their hormone content or the functions they play in this species. Here, we used a combination of immunohistochemistry and mass spectrometric techniques to investigate these questions. Using immunohistochemistry, we identified both SIFamide-and tachykinin-related peptide (TRP)-like immunopositive cells in the midgut epithelium of C. magister, as well as in that of Cancer borealis and Cancer productus. In each species, the SIFamide-like labeling was restricted to the anterior portion of the midgut, including the paired anterior midgut caeca, whereas the TRP-like immunoreactivity predominated in the posterior midgut and the posterior midgut caecum. Regardless of location, label or species, the morphology of the immunopositive cells matched that of the putative endocrine cells characterized ultrastructurally by Mykles (Mykles, 1979). Matrix-assisted laser desorption/ ionization-Fourier transform mass spectrometry identified the peptides responsible for the immunoreactivities as GYRKPPFNGSIFamide (Gly 1-SIFamide) and APSGFLGMRamide [Cancer boreatis tachykinin-related peptide Ia (CabTRP Ia)], respectively, both of which are known neuropeptides of Cancer species. Although the function of these midgut-derived peptides remains unknown, we found that both Gly1-SIFamide and CabTRP Ia were released when the midgut was exposed to high-potassium saline. In addition, CabTRP Ia was detectable in the hemolymph of crabs that had been held without food for several days, but not in that of fed animals, paralleling results that were attributed to TRP release from midgut endocrine cells in insects. Thus, one function that midgut-derived CabTRP Ia may play in Cancer species is paracrine/hormonal control of feeding-related behavior, as has been postulated for TRPs released from homologous cells in insects.
Neurotransmitter interactions in the stomatogastric system of the spiny lobster: One peptide alters the response of a central pattern generator to a second peptide
Date: 1997-01-01
Creator: Patsy S. Dickinson, Wesley P. Fairfield, John R. Hetling, Jane Hauptman
Access: Open access
- Two of the peptides found in the stomatogastric nervous system of the spiny lobster. Panulirus interruptus, interacted to modulate the activity of the cardiac sac motor pattern. In the isolated stomatogastric ganglion, red- pigment-concentrating hormone (RPCH), but not proctolin, activated the bursting activity in the inferior ventricular (IV) neurons that drives the cardiac sac pattern. The cardiac sac pattern normally ceased within 15 min after the end of RPCH superfusion. However, when proctolin was applied within a few minutes of that time, it was likewise able to induce cardiac sac activity. Similarly, proctolin applied together with subthreshold RPCH induced cardiac sac bursting. The amplitude of the excitatory postsynaptic potentials from the IV neurons to the cardiac sac dilator neuron CD2 (1 of the 2 major motor neurons in the cardiac sac system) was potentiated in the presence of both proctolin and RPCH. The potentiation in RPCH was much greater than in proctolin alone. However, the potentiation in proctolin after RPCH was equivalent to that recorded in RPCH alone. Although we do not yet understand the mechanisms for these interactions of the two modulators, this study provides an example of one factor that can determine the 'state' of the system that is critical in determining the effect of a modulator that is 'state dependent,' and it provides evidence for yet another level of flexibility in the motor output of this system.
Identification and characterization of genes involved in Helicobacter pylori lipopolysaccharide and glycoprotein biosynthesis Access to this record is restricted to members of the Bowdoin community. Log in here to view.
Date: 2021-01-01
Creator: Andrew James Mulholland
Access: Access restricted to the Bowdoin Community
Determining the sites at which neuromodulators exert peripheral effects in the cardiac neuromuscular system of the American Lobster, Homarus americanus
Date: 2021-01-01
Creator: Audrey Elizabeth Jordan
Access: Open access
- Networks of neurons known as central pattern generators (CPGs) generate rhythmic patterns of output to drive behaviors like locomotion. CPGs are relatively fixed networks that produce consistent patterns in the absence of other inputs. The heart contractions of the Homarus americanus are neurogenic and controlled by the CPG known as the cardiac ganglion. Neuromodulators can enable flexibility in CPG motor output, and also on muscle contractions by acting on the neuromuscular junction and the muscle itself. A tissue-specific transcriptome gleaned from the cardiac ganglion and cardiac muscle of the American lobster was used to predict the sites and sources of a variety of crustacean neuromodulators. If corresponding receptors were predicted to be expressed in the cardiac muscle, then it was hypothesized that the neuropeptide had peripheral effects. One peptide for which a cardiac muscle receptor was identified is myosuppressin. Myosuppressin has been shown to have modulatory effects at the cardiac neuromuscular system of the American lobster. In previous research, myosuppressin had modulatory effects on the periphery of cardiac neuromuscular system alone. It remains an open question of whether myosuppressin acts on the cardiac muscle directly, if it is exerting its effects at the neuromuscular junction (NMJ), or both. To test this, I performed physiological experiments on the isolated NMJ. Myosuppressin did not modulate the amplitude of the excitatory junction potentials. Since no modulatory effects were seen at the NMJ, the cardiac muscle was isolated from the cardiac ganglion and then glutamate-evoked contractions were stimulated. I showed that myosuppressin increased glutamate-evoked contraction amplitude. These data suggest myosuppressin exerts its peripheral effects at the cardiac muscle and not the NMJ.
Bowdoin College Catalogue (1931-1932)
Date: 1932-01-01
Access: Open access
- Bowdoin College Bulletin no. 202
Clonal growth: Invasion or stability? A comparative study of clonal architecture and diversity in native and introduced lineages of Phragmites australis (Poaceae)
Date: 2014-09-01
Creator: Vladimir Douhovnikoff, Eric L.G. Hazelton
Access: Open access
- Premise of the study: The characteristics of clonal growth that are advantageous in invasive plants can also result in native plants’ ability to resist invasion. In Maine, we compared the clonal architecture and diversity of an invasive lineage (introduced Phragmites) and a noninvasive lineage (native Phragmites) present in much of North America. This study is the fi rst on standscale diversity using a sample size and systematic spatial-sampling scheme adequate for characterizing clonal structure in Phragmites. Our questions included: (1) Does the structure and extent of clonal growth suggest that the potential for clonal growth contributes to the invasiveness of the introduced lineage? (2) Is clonal growth common in the native lineage, acting as a possible source of ecological resistance and resilience?
Los trucos debajo de la mesa: Juegos y simulacros en la cultura y literatura argentina Access to this record is restricted to members of the Bowdoin community. Log in here to view.
- Restriction End Date: 2025-06-01
Date: 2020-01-01
Creator: Eliana Miller
Access: Access restricted to the Bowdoin Community
Investigating the Effect of Side Chains with Hydrogen Bonding Capabilities on Peptoid Catalysts for Enantioselective Trifluoromethylation of 4-Chlorobenzaldehyde Access to this record is restricted to members of the Bowdoin community. Log in here to view.
- Restriction End Date: 2025-06-01
Date: 2020-01-01
Creator: Rebecca Londoner
Access: Access restricted to the Bowdoin Community
A structural role for arginine in proteins: Multiple hydrogen bonds to backbone carbonyl oxygens
Date: 1994-01-01
Creator: C. L. Borders, John A. Broadwater, Paula A. Bekeny, Johanna E. Salmon, Ann S., Lee, Aimee M. Eldridge, Virginia B. Pett
Access: Open access
- We propose that arginine side chains often play a previously unappreciated general structural role in the maintenance of tertiary structure in proteins, wherein the positively charged guanidinium group forms multiple hydrogen bonds to backbone carbonyl oxygens. Using as a criterion for a “structural” arginine one that forms 4 or more hydrogen bonds to 3 or more backbone carbonyl oxygens, we have used molecular graphics to locate arginines of interest in 4 proteins: Arg 180 in Thermus thermophilus manganese superoxide dismutase, Arg 254 in human carbonic anhydrase II, Arg 31 in Streptomyces rubiginosus xylose isomerase, and Arg 313 in Rhodospirillum rubrum ribulose‐1,5‐bisphosphate carboxylase/oxygenase. Arg 180 helps to mold the active site channel of superoxide dismutase, whereas in each of the other enzymes the structural arginine is buried in the “mantle” (i.e., inside, but near the surface) of the protein interior well removed from the active site, where it makes 5 hydrogen bonds to 4 backbone carbonyl oxygens. Using a more relaxed criterion of 3 or more hydrogen bonds to 2 or more backbone carbonyl oxygens, arginines that play a potentially important structural role were found in yeast enolase, Bacillus stearothermophilus glyceraldehyde‐3‐phosphate dehydrogenase, bacteriophage T4 and human lysozymes, Enteromorpha prolifera plastocyanin, HIV‐1 protease, Trypanosoma brucei brucei and yeast triosephosphate isomerases, and Escherichia coli trp aporepressor (but not trp repressor or the trp repressor/operator complex). In addition to helping form the active site funnel in superoxide dismutase, the structural arginines found in this study play such diverse roles as stapling together 3 strands of backbone from different regions of the primary sequence, and tying α‐helix to α‐helix, βturn to β‐turn, and subunit to subunit. Copyright © 1994 The Protein Society