Showing 51 - 60 of 274 Items
Molecular, mass spectral, and physiological analyses of orcokinins and orcokinin precursor-related peptides in the lobster Homarus americanus and the crayfish Procambarus clarkii
Date: 2009-02-01
Creator: Patsy S. Dickinson, Elizabeth A. Stemmler, Elizabeth E. Barton, Christopher R. Cashman, Noah P., Gardner, Szymon Rus, Henry R. Brennan, Timothy S. McClintock, Andrew E. Christie
Access: Open access
- Recently, cDNAs encoding prepro-orcokinins were cloned from the crayfish Procambarus clarkii; these cDNAs encode multiple copies of four orcokinin isoforms as well as several other peptides. Using the translated open reading frames of the P. clarkii transcripts as queries, five ESTs encoding American lobster Homarus americanus orthologs were identified via BLAST analysis. From these clones, three cDNAs, each encoding one of two distinct prepro-hormones, were characterized. Predicted processing of the deduced prepro-hormones would generate 13 peptides, 12 of which are conserved between the 2 precursors: the orcokinins NFDEIDRSGFGFN (3 copies), NFDEIDRSGFGFH (2 copies) and NFDEIDRSGFGFV (2 copies), FDAFTTGFGHN (an orcomyotropin-related peptide), SSEDMDRLGFGFN, GDY(SO3)DVYPE, VYGPRDIANLY and SAE. Additionally, one of two longer peptides (GPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPV or APARSSPQQDAAAGYTDGAPV) is predicted from each prepro-hormone. MALDI-FTMS analyses confirmed the presence of all predicted orcokinins, the orcomyotropin-related peptide, and three precursor-related peptides, SSEDMDRLGFGFN, GDYDVYPE (unsulfated) and VYGPRDIANLY, in H. americanus neural tissues. SAE and the longer, unshared peptides were not detected. Similar complements of peptides are predicted from P. clarkii transcripts; the majority of these were detected in its neural tissues with mass spectrometry. Truncated orcokinins not predicted from any precursor were also detected in both species. Consistent with previous studies in the crayfish Orconectes limosus, NFDEIDRSGFGFN increased mid-/hindgut motility in P. clarkii. Surprisingly, the same peptide, although native to H. americanus, did not affect gut motility in this species. Together, our results provide the framework for future investigations of the regulation and physiological function of orcokinins/orcokinin precursor-related peptides in astacideans. © 2008 Elsevier Inc. All rights reserved.
Midgut epithelial endocrine cells are a rich source of the neuropeptides APSGFLGMRamide (Cancer borealis tachykinin-related peptide Ia) and GYRKPPFNGSIFamide (Gly1-SIFamide) in the crabs Cancer borealis, Cancer magister and Cancer productus
Date: 2007-02-01
Creator: Andrew E. Christie, Kimberly K. Kutz-Naber, Elizabeth A. Stemmler, Alexandra Klein, Daniel I., Messinger, Christopher C. Goiney, Anna J. Conterato, Emily A. Bruns, Yun Wei A. Hsu, Lingjun Li, Patsy S. Dickinson
Access: Open access
- Over a quarter of a century ago, Mykles described the presence of putative endocrine cells in the midgut epithelium of the crab Cancer magister (Mykles, 1979). In the years that have followed, these cells have been largely ignored and nothing is known about their hormone content or the functions they play in this species. Here, we used a combination of immunohistochemistry and mass spectrometric techniques to investigate these questions. Using immunohistochemistry, we identified both SIFamide-and tachykinin-related peptide (TRP)-like immunopositive cells in the midgut epithelium of C. magister, as well as in that of Cancer borealis and Cancer productus. In each species, the SIFamide-like labeling was restricted to the anterior portion of the midgut, including the paired anterior midgut caeca, whereas the TRP-like immunoreactivity predominated in the posterior midgut and the posterior midgut caecum. Regardless of location, label or species, the morphology of the immunopositive cells matched that of the putative endocrine cells characterized ultrastructurally by Mykles (Mykles, 1979). Matrix-assisted laser desorption/ ionization-Fourier transform mass spectrometry identified the peptides responsible for the immunoreactivities as GYRKPPFNGSIFamide (Gly 1-SIFamide) and APSGFLGMRamide [Cancer boreatis tachykinin-related peptide Ia (CabTRP Ia)], respectively, both of which are known neuropeptides of Cancer species. Although the function of these midgut-derived peptides remains unknown, we found that both Gly1-SIFamide and CabTRP Ia were released when the midgut was exposed to high-potassium saline. In addition, CabTRP Ia was detectable in the hemolymph of crabs that had been held without food for several days, but not in that of fed animals, paralleling results that were attributed to TRP release from midgut endocrine cells in insects. Thus, one function that midgut-derived CabTRP Ia may play in Cancer species is paracrine/hormonal control of feeding-related behavior, as has been postulated for TRPs released from homologous cells in insects.
Neurotransmitter interactions in the stomatogastric system of the spiny lobster: One peptide alters the response of a central pattern generator to a second peptide
Date: 1997-01-01
Creator: Patsy S. Dickinson, Wesley P. Fairfield, John R. Hetling, Jane Hauptman
Access: Open access
- Two of the peptides found in the stomatogastric nervous system of the spiny lobster. Panulirus interruptus, interacted to modulate the activity of the cardiac sac motor pattern. In the isolated stomatogastric ganglion, red- pigment-concentrating hormone (RPCH), but not proctolin, activated the bursting activity in the inferior ventricular (IV) neurons that drives the cardiac sac pattern. The cardiac sac pattern normally ceased within 15 min after the end of RPCH superfusion. However, when proctolin was applied within a few minutes of that time, it was likewise able to induce cardiac sac activity. Similarly, proctolin applied together with subthreshold RPCH induced cardiac sac bursting. The amplitude of the excitatory postsynaptic potentials from the IV neurons to the cardiac sac dilator neuron CD2 (1 of the 2 major motor neurons in the cardiac sac system) was potentiated in the presence of both proctolin and RPCH. The potentiation in RPCH was much greater than in proctolin alone. However, the potentiation in proctolin after RPCH was equivalent to that recorded in RPCH alone. Although we do not yet understand the mechanisms for these interactions of the two modulators, this study provides an example of one factor that can determine the 'state' of the system that is critical in determining the effect of a modulator that is 'state dependent,' and it provides evidence for yet another level of flexibility in the motor output of this system.
Clonal growth: Invasion or stability? A comparative study of clonal architecture and diversity in native and introduced lineages of Phragmites australis (Poaceae)
Date: 2014-09-01
Creator: Vladimir Douhovnikoff, Eric L.G. Hazelton
Access: Open access
- Premise of the study: The characteristics of clonal growth that are advantageous in invasive plants can also result in native plants’ ability to resist invasion. In Maine, we compared the clonal architecture and diversity of an invasive lineage (introduced Phragmites) and a noninvasive lineage (native Phragmites) present in much of North America. This study is the fi rst on standscale diversity using a sample size and systematic spatial-sampling scheme adequate for characterizing clonal structure in Phragmites. Our questions included: (1) Does the structure and extent of clonal growth suggest that the potential for clonal growth contributes to the invasiveness of the introduced lineage? (2) Is clonal growth common in the native lineage, acting as a possible source of ecological resistance and resilience?
A structural role for arginine in proteins: Multiple hydrogen bonds to backbone carbonyl oxygens
Date: 1994-01-01
Creator: C. L. Borders, John A. Broadwater, Paula A. Bekeny, Johanna E. Salmon, Ann S., Lee, Aimee M. Eldridge, Virginia B. Pett
Access: Open access
- We propose that arginine side chains often play a previously unappreciated general structural role in the maintenance of tertiary structure in proteins, wherein the positively charged guanidinium group forms multiple hydrogen bonds to backbone carbonyl oxygens. Using as a criterion for a “structural” arginine one that forms 4 or more hydrogen bonds to 3 or more backbone carbonyl oxygens, we have used molecular graphics to locate arginines of interest in 4 proteins: Arg 180 in Thermus thermophilus manganese superoxide dismutase, Arg 254 in human carbonic anhydrase II, Arg 31 in Streptomyces rubiginosus xylose isomerase, and Arg 313 in Rhodospirillum rubrum ribulose‐1,5‐bisphosphate carboxylase/oxygenase. Arg 180 helps to mold the active site channel of superoxide dismutase, whereas in each of the other enzymes the structural arginine is buried in the “mantle” (i.e., inside, but near the surface) of the protein interior well removed from the active site, where it makes 5 hydrogen bonds to 4 backbone carbonyl oxygens. Using a more relaxed criterion of 3 or more hydrogen bonds to 2 or more backbone carbonyl oxygens, arginines that play a potentially important structural role were found in yeast enolase, Bacillus stearothermophilus glyceraldehyde‐3‐phosphate dehydrogenase, bacteriophage T4 and human lysozymes, Enteromorpha prolifera plastocyanin, HIV‐1 protease, Trypanosoma brucei brucei and yeast triosephosphate isomerases, and Escherichia coli trp aporepressor (but not trp repressor or the trp repressor/operator complex). In addition to helping form the active site funnel in superoxide dismutase, the structural arginines found in this study play such diverse roles as stapling together 3 strands of backbone from different regions of the primary sequence, and tying α‐helix to α‐helix, βturn to β‐turn, and subunit to subunit. Copyright © 1994 The Protein Society
Clonal diversity in an expanding community of Arctic Salix spp. and a model for recruitment modes of arctic plants
Date: 2010-11-01
Creator: Vladimir Douhovnikoff, Gregory R. Goldsmith, Ken D. Tape, Cherrie Huang, Nadine, Sur, M. Syndonia Bret-Harte
Access: Open access
- Rapid climate change in arctic environments is leading to a widespread expansion in woody deciduous shrub populations. However, little is known about the reproductive, dispersal, and establishment mechanisms associated with shrub expansion. It is assumed that harsh environmental conditions impose limitations on plant sexual reproduction in the Arctic, such that population survival and expansion is predominately a function of clonal recruitment. We present contrary evidence from microsatellite genetic data suggesting the prevalence of recruitment by seed. Further, we present a conceptual model describing modes of recruitment in relation to the abiotic environment. Climate change may be alleviating abiotic stress so that resources are available for more frequent recruitment by seed. Such changes have widespread implications for ecosystem structure and functioning, including species composition, wildlife habitat, biogeochemical cycling, and surface energy balance. © 2010 Regents of the University of Colorado.
The development of begging calls in Yellow Warblers
Date: 2015-05-01
Creator: Jackson F Bloch
Access: Open access
- Nestling birds use begging calls to solicit resources from adults. Efficient transmission of calls is necessary for motivating parental feeding and outcompeting siblings. However, ambient acoustic masking and costs such as predation may influence the structure of the calls. While many interspecific comparisons of begging behavior have been made, the ontogeny of calls is understudied. In this study, Yellow Warbler (Setophaga petechia) begging calls were recorded and analyzed at different stages of nestling development to document changes in acoustic structure and gain insight into the selective forces that influence call development. Begging calls increased in peak frequency, frequency range, and amplitude during the 5-day recording period. Call duration did not change with age. Call structure did not differ between nestlings living in distinct acoustic environments. As begging calls increase in amplitude with age, perhaps due to increased food needs and competition from nestmates, nestlings may compensate for increased predation risk by increasing the peak frequency of the calls. Higher frequency calls attenuate more quickly than do low frequency calls and fall outside the frequency range of maximum hearing sensitivity for some potential predators. Previous studies on warbler begging have shown that nestlings of ground-nesting warblers, which are subject to higher rates of predation, beg at higher frequencies than do nestlings of tree-nesting warblers. This study supports the hypothesis that changes to begging call structure during development mirror the differences in call structure of species under different predation risks.
Phenotypic divergence between sites in photosynthetic thermal response despite low genetic differentiation in Gulf of Maine Ascophyllum nodosum This record is embargoed.
- Embargo End Date: 2028-05-18
Date: 2023-01-01
Creator: Olivia Bronzo-Munich
Access: Embargoed
Host and symbiont-specific patterns of gene expression in response to cold stress in the temperate coral Astrangia poculata
Date: 2023-01-01
Creator: Kellie Navarro
Access: Open access
- The coral Astrangia poculata inhabits hard-bottom environments from the Gulf of Mexico to Massachusetts and withstands large seasonal variation in temperature (–2 to 26 °C). This thermal range and its ability to live in a facultative symbiosis makes this species an ideal model system for investigating stress responses to ocean temperature variation. Although it has been shown that aposymbiotic A. poculata upregulates more genes in response to cold stress than heat stress, the transcriptomic response of the holobiont (coral host and symbiotic algae) to stress is unknown. In this study, we characterize changes in gene expression in both the host and symbionts under cold stress (6ºC) and ambient (12ºC) seawater temperatures. We use RNAseq to visualize how patterns of global gene expression change in response to these temperatures within the transcriptomes of replicate corals (n=10, each temperature) and their symbiont partners. By filtering the holobiont assembly for known coral host and symbiont genes, we contrasted patterns of differential expression (DE) for each partner and the functional processes for each set of DE genes. Differential gene expression analyses revealed that the cnidarian coral host responds strongly to cold stress, while algal symbionts did not have a significant stress response. In the coral host, we found up-regulation of biological processes associated with DNA repair, immunity, and maintaining cellular homeostasis as well as downregulation of mechanisms associated with DNA repair and RNA splicing, indicating inhibition of necessary cellular processes due to environmental stress.
ELMO, A Possible Pectin Biosynthesis Scaffold Access to this record is restricted to members of the Bowdoin community. Log in here to view.
Date: 2023-01-01
Creator: Nuoya (Laura) Yang
Access: Access restricted to the Bowdoin Community